Skip to product information
1 of 1

Gene Bio Systems

Recombinant Plantago lanceolata Major pollen allergen Pla l 1

Recombinant Plantago lanceolata Major pollen allergen Pla l 1

SKU:CSB-EP307243PLG

Regular price £893.00 GBP
Regular price Sale price £893.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: P82242

Gene Names: N/A

Organism: Plantago lanceolata (English plantain) (Ribwort plantain)

AA Sequence: TQTSHPAKFHVEGEVYCNVCHSRNLINELSERMAGAQVQLDCKDDSKKVIYSIGGETDQDGVYRLPVVGYHEDCEIKLVKSSRPDCSEIPKLAKGTIQTSKVDLSKNTTITEKTRHVKPLSFRAKTDAPGC

Expression Region: 1-131aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 30.5 kDa

Alternative Name(s): Allergen: Pla l 1

Relevance:

Reference: "Cloning and expression of biologically active Plantago lanceolata pollen allergen Pla l 1 in the yeast Pichia pastoris."Calabozo B., Diaz-Perales A., Salcedo G., Barber D., Polo F.Biochem. J. 372:889-896(2003)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details