Skip to product information
1 of 1

Gene Bio Systems

Recombinant Pisum sativum Chlorophyll a-b binding protein 8, chloroplastic(CAB8)

Recombinant Pisum sativum Chlorophyll a-b binding protein 8, chloroplastic(CAB8)

SKU:CSB-CF333262EWE

Regular price £1,295.00 GBP
Regular price Sale price £1,295.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Pisum sativum (Garden pea)

Uniprot NO.:P27490

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:RKSATTKKVASSGSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFSK NRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVH AQSILAIWATQVILMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEAFAELKVKE LKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLSDPVNNNAWSYATNFVPGK

Protein Names:Recommended name: Chlorophyll a-b binding protein 8, chloroplastic Alternative name(s): LHCII type I CAB-8

Gene Names:Name:CAB8 Synonyms:LHCB1

Expression Region:37-268

Sequence Info:full length protein

View full details