Skip to product information
1 of 1

Gene Bio Systems

Recombinant Pig Translocator protein(TSPO)

Recombinant Pig Translocator protein(TSPO)

SKU:CSB-CF764926PI

Regular price £1,211.00 GBP
Regular price Sale price £1,211.00 GBP
Sale Sold out
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 10ug

Updated Date: Stock Protein updated on 20171228

Research areas: Cancer

Target / Protein: TSPO

Biologically active: Not Tested

Expression system: in vitro E.coli expression system

Species of origin: Sus scrofa (Pig)

Delivery time: 3-7 business days

Uniprot ID: Q6UN27

AA Sequence: MAPPWLPAVGFTLVPSLGGFLSSRNVLGKGLHWYAGLQKPSWHPPHWTLAPIWGTLYSAMGYGSYMIWKELGGFSEEAVVPLGLYAGQLALNWAWPPLFFGARQMGWALVDLVLTGGVAAATAVAWYQVSPLAARLLYPYLAWLAFAATLNYCVWRDNQGRRGGRRPSE

Tag info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Expression Region: 1-169aa

Protein length: Full Length

MW: 38.6 kDa

Alternative Name(s): Peripheral-type benzodiazepine receptor

Relevance: Promotes the transport of cholesterol across mitochondrial membranes and may play a role in lipid metabolism, but its precise physiological role is controversial. It is apparently not required for steroid hormone biosynthesis. Can bind protoporphyrin IX and may play a role in the transport of porphyrins and heme. Was initially identified as peripheral-type benzodiazepine receptor; can also bind isoquinoline carboxamides

Reference: "Cloning, sequencing, and chromosomal localization of pig peripheral benzodiazepine receptor: three different forms produced by alternative splicing." Zhang K., Demeure O., Belliard A., Goujon J.M., Favreau F., Desurmont T., Mauco G., Barriere M., Carretier M., Milan D., Papadopoulos V., Hauet T. Mamm. Genome 17:1050-1062(2006)

Purity: Greater than 85% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details