Recombinant Pig Transcobalamin-1(TCN1)

SKU: CSB-YP023317PI

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 22-32 working days

Research Topic: Others

Uniprot ID: P17630

Gene Names: TCN1

Organism: Sus scrofa (Pig)

AA Sequence: CVVSEKDYSHLRLLISAMDNLEQIRGIYGASILLSQRLAGIQNPSLEEELSQRIQDDMNRRDMSNLTSGQLALIILAFGACKTPDVRFIHDHHLVEKLGEKFKEEIKNMEIHNSNPLTNYYQLSFDVLTLCLFRGNYSISNVTHYFNPENKNFNLSGHFSVDTGAVAVLALTCVKRSISNGKIKAAIKDSDTIQKYIESLVHKIQSEKMVVSLETRIAQEKLCRLSLSHQTITKMNQIAKKLWTRCLTHSQGVFRLPIAAAQILPALLGKTYLDVTKLLLVPKVQVNITDEPVPVVPTLSPENISVIYCVKINEISNCINITVFLDVMKAAQEKNSTIYGFTMTETPWGPYITSVQGIWANNNERTYWEHSEQQQITKPRSMGIMLSKMESI

Expression Region: 25-416aa

Sequence Info: Full Length

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

MW: 46.3 kDa

Alternative Name(s): CobalophilinHaptocorrin;Protein RTranscobalamin I ;TC I ;TCI

Relevance: Binds vitamin B12 with ftomolar affinity and protects it from the acidic environment of the stomach . Binds to cobalamin and to cobalamin analogs such as cobinamide.

Reference: Isolation and characterization of a cDNA encoding porcine gastric haptocorrin.Hewitt J.E., Seetharam B., Leykam J.F., Alpers D.H.Eur. J. Biochem. 189:125-130(1990)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer，50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.