Gene Bio Systems
Recombinant Pig Signal peptidase complex subunit 1(SPCS1)
Recombinant Pig Signal peptidase complex subunit 1(SPCS1)
SKU:CSB-CF022514PI
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Sus scrofa (Pig)
Uniprot NO.:B0FWK4
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MLEHLSSLPTQMDYKGQKLAEQMFQGIILFSAIVGFIYGYVAEQFGWTVYIVMAGFAFSC LLTLPPWPIYRRHPLKWLPVQDSGTEDKKPGERKIKRHAKNN
Protein Names:Recommended name: Signal peptidase complex subunit 1 EC= 3.4.-.- Alternative name(s): Microsomal signal peptidase 12 kDa subunit Short name= SPase 12 kDa subunit
Gene Names:Name:SPCS1 Synonyms:SPC12
Expression Region:1-102
Sequence Info:Full length protein
