Skip to product information
1 of 1

Gene Bio Systems

Recombinant Pig Protein delta homolog 2(DLK2)

Recombinant Pig Protein delta homolog 2(DLK2)

SKU:CSB-CF006946PI

Regular price £1,428.00 GBP
Regular price Sale price £1,428.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Sus scrofa (Pig)

Uniprot NO.:B2LW77

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:DDCSSHCDLAHGCCAPDGSCRCDPGWEGLHCERCVRMPGCQHGTCHQPWQCICHSGWAGKFCDKDEHVCTTQSPCRNGGQCIYDGGGEYHCVCPPGFHGRDCERKEGPCEQAGSPCRNGGQCQDDQGFALNYTCRCLAGFVGAHCEVNVDDCLMRPCANGATCLDGINRFSCLCPEGFAGRFCTINLDDCASRPCQRGARCRDRVHDFDCLCPSGYGGKTCELVLPVPDPATTADIPPGPTLAVVVPATGPIPHSAGAGLLRISVKEVVRRQEAGLGKSSLVAVVVFGAVTATLVLSTVLLTLRAWRRGVCPPGPCCYPAPHYAPARQDQECQVSMLPAGLPLPPDLPPEPGKTTAL

Protein Names:Recommended name: Protein delta homolog 2 Short name= DLK-2 Alternative name(s): Epidermal growth factor-like protein 9 Short name= EGF-like protein 9

Gene Names:Name:DLK2 Synonyms:EGFL9

Expression Region:27-383

Sequence Info:full length protein

View full details