Skip to product information
1 of 1

Gene Bio Systems

Recombinant Pig N-acetyllactosaminide alpha-1,3-galactosyltransferase(GGTA1)

Recombinant Pig N-acetyllactosaminide alpha-1,3-galactosyltransferase(GGTA1)

SKU:CSB-CF009400PI

Regular price £1,441.00 GBP
Regular price Sale price £1,441.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Sus scrofa (Pig)

Uniprot NO.:P50127

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNVKGRVVLSMLLVSTVMVVFWEYINSPEGSLFWIYQSKNPEVGSSAQRGWWFPSWFNNGTHSYHEEEDAIGNEKEQRKEDNRGELPLVDWFNPEKRPEVVTITRWKAPVVWEGTYNRAVLDNYYAKQKITVGLTVFAVGRYIEHYLEEFLISANTYFMVGHKVIFYIMVDDISRMPLIELGPLRSFKVFEIKSEKRWQDISMMRMKTIGEHILAHIQHEVDFLFCMDVDQVFQNNFGVETLGQSVAQLQAWWYKAHPDEFTYERRKESAAYIPFGQGDFYYHAAIFGGTPTQVLNITQECFKGILQDKENDIEAEWHDESHLNKYFLLNKPTKILSPEYCWDYHIGMSVDIRIVKIAWQKKEYNLVRNNI

Protein Names:Recommended name: N-acetyllactosaminide alpha-1,3-galactosyltransferase EC= 2.4.1.87 Alternative name(s): UDP-galactose:beta-D-galactosyl-1,4-N-acetyl-D-glucosaminide alpha-1,3-galactosyltransferase Short name= Galactosyltransferase

Gene Names:Name:GGTA1

Expression Region:1-371

Sequence Info:full length protein

View full details