Gene Bio Systems
Recombinant Pig High affinity copper uptake protein 1(SLC31A1)
Recombinant Pig High affinity copper uptake protein 1(SLC31A1)
SKU:CSB-CF823864PI
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Sus scrofa (Pig)
Uniprot NO.:Q8WNR0
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MDHSAHMGMSTHMGMSDMNHSTTMPPSHHHPTSSGSHESMMMPMTFYFGFKKVEVLFAGL VINTAGEMAGAFVAVFLLAMFYEGLKIAREGLLRKSQVSIRYNSMPVPGPNGTILMETHK TVGQQMLSFPHLLQTVLHIIQVVISYFLMLIFMTYNGYLCIAVAAGAGTGYFLFSWKKAV VVDITEHCH
Protein Names:Recommended name: High affinity copper uptake protein 1 Alternative name(s): Copper transporter 1 Short name= CTR1 Solute carrier family 31 member 1
Gene Names:Name:SLC31A1 Synonyms:CTR1
Expression Region:1-189
Sequence Info:full length protein
