Skip to product information
1 of 1

Gene Bio Systems

Recombinant Pig High affinity copper uptake protein 1(SLC31A1)

Recombinant Pig High affinity copper uptake protein 1(SLC31A1)

SKU:CSB-CF823864PI

Regular price £1,256.00 GBP
Regular price Sale price £1,256.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Sus scrofa (Pig)

Uniprot NO.:Q8WNR0

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MDHSAHMGMSTHMGMSDMNHSTTMPPSHHHPTSSGSHESMMMPMTFYFGFKKVEVLFAGL VINTAGEMAGAFVAVFLLAMFYEGLKIAREGLLRKSQVSIRYNSMPVPGPNGTILMETHK TVGQQMLSFPHLLQTVLHIIQVVISYFLMLIFMTYNGYLCIAVAAGAGTGYFLFSWKKAV VVDITEHCH

Protein Names:Recommended name: High affinity copper uptake protein 1 Alternative name(s): Copper transporter 1 Short name= CTR1 Solute carrier family 31 member 1

Gene Names:Name:SLC31A1 Synonyms:CTR1

Expression Region:1-189

Sequence Info:full length protein

View full details