Skip to product information
1 of 1

Gene Bio Systems

Recombinant Pig Growth hormone receptor(GHR),partial

Recombinant Pig Growth hormone receptor(GHR),partial

SKU:CSB-EP009411PI-GB

Regular price £679.00 GBP
Regular price Sale price £679.00 GBP
Sale Sold out
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20171228

Research areas: Cell Biology

Target / Protein: GHR

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Sus scrofa (Pig)

Delivery time: 3-7 business days

Uniprot ID: P19756

AA Sequence: FSGSEATPAVLVRASQSLQRVHPGLETNSSGKPKFTKCRSPELETFSCHWTDGVRHGLQSPGSIQLFYIRRSTQEWTQEWKECPDYVSAGENSCYFNSSYTSIWIPYCIKLTSNGGTVDQKCFSVEEIVQPDPPIGLNWTLLNISLTGIHADIQVRWEPPPNADVQKGWIVLEYELQYKEVNETQWKMMDPVLSTSVPVYSLRLDKEYEVRVRSRQRNSEKYGEFSEVLYVTLPQMSPFACEEDFR

Tag info: C-terminal 6xHis-tagged

Expression Region: 19-264aa

Protein length: Partial

MW: 30.3 kDa

Alternative Name(s): Somatotropin receptor

Relevance: Receptor for pituitary gland growth hormone involved in regulating postnatal body growth. On ligand binding, couples to, and activates the JAK2/STAT5 pathway. The soluble form (GHBP) acts as a reservoir of growth hormone in plasma and may be a modulator/inhibitor of GH signaling.

Reference: "Porcine growth hormone receptor cDNA sequence." Cioffi J.A., Wang X., Kopchick J.J. Nucleic Acids Res. 18:6451-6451(1990)

Purity: Greater than 85% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details