Skip to product information
1 of 1

Gene Bio Systems

Recombinant Pig Cytochrome c oxidase subunit 6C(COX6C)

Recombinant Pig Cytochrome c oxidase subunit 6C(COX6C)

SKU:CSB-CF005856PI

Regular price £1,058.00 GBP
Regular price Sale price £1,058.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Sus scrofa (Pig)

Uniprot NO.:A1XQT2

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:ATSSLTKPQMRWPSGPRRLRFHIVGAFIVSLGVATFYKFAVAEPRKKAYADFYRNYDSMK DFEEMRKAGIFQSAK

Protein Names:Recommended name: Cytochrome c oxidase subunit 6C Alternative name(s): Cytochrome c oxidase polypeptide VIc

Gene Names:Name:COX6C

Expression Region:2-76

Sequence Info:Full length protein

View full details