Skip to product information
1 of 1

Gene Bio Systems

Recombinant Pig Bcl-2-like protein 1(BCL2L1)

Recombinant Pig Bcl-2-like protein 1(BCL2L1)

SKU:CSB-CF002613PI

Regular price £1,295.00 GBP
Regular price Sale price £1,295.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Sus scrofa (Pig)

Uniprot NO.:O77737

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSQSNRELVVDFLSYKLSQKGYSWSQFTDVEENRTEAPEGTESEAETPSAINGNPSWHLA DSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY QSFEQVLNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIATWMATYLNDHLEP WIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTLAGVVLLGSLFSRK

Protein Names:Recommended name: Bcl-2-like protein 1 Short name= Bcl2-L-1 Alternative name(s): Apoptosis regulator Bcl-X

Gene Names:Name:BCL2L1 Synonyms:BCLX, BLC2L

Expression Region:1-233

Sequence Info:Full length protein

View full details