Skip to product information
1 of 1

Gene Bio Systems

Recombinant Pig Bax inhibitor 1(TMBIM6)

Recombinant Pig Bax inhibitor 1(TMBIM6)

SKU:CSB-CF724148PI

Regular price £1,315.00 GBP
Regular price Sale price £1,315.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Sus scrofa (Pig)

Uniprot NO.:Q66RM2

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNIFDRKINFDALLKFSHITPSTQQHLKKVYASFALCMFVAAAGAYVHVVTRFIQAGLLS ALGSLGLMIWLMATPHSHETEQKRLGLLAGFAFLTGVGLGPALDLCIAINPSILPTAFMG TAMIFTCFTLSALYARRRSYLFLGGILMSAMSLMVLSSLGNLFFGSIWLFQANLYVGLVV MCGFVLFDTQLIIEKAENGDKDYIWHCVDLFSDFVTLFRKLMMILAMNEKDKKKEKK

Protein Names:Recommended name: Bax inhibitor 1 Short name= BI-1 Alternative name(s): Testis-enhanced gene transcript protein Transmembrane BAX inhibitor motif-containing protein 6

Gene Names:Name:TMBIM6 Synonyms:TEGT

Expression Region:1-237

Sequence Info:full length protein

View full details