Skip to product information
1 of 1

Gene Bio Systems

Recombinant Pig 5-hydroxytryptamine receptor 1E(HTR1E)

Recombinant Pig 5-hydroxytryptamine receptor 1E(HTR1E)

SKU:CSB-CF639964PI

Regular price £1,221.00 GBP
Regular price Sale price £1,221.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Sus scrofa (Pig)

Uniprot NO.:Q29003

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:HQPANYLICSLAVTDLLVAVLVMPLSIMYIVMDSWRLGYFICEVWLSVDMTCCTCSILHL CVIALDRYWAITNAIEYARKRTAKRAGLMILTVWTISIFISMPPLFWRSHRQLSPPPSQC AIQHDHVIYTIYSTLGAFYIPLTLILILY

Protein Names:Recommended name: 5-hydroxytryptamine receptor 1E Short name= 5-HT-1E Short name= 5-HT1E Alternative name(s): Serotonin receptor 1E

Gene Names:Name:HTR1E

Expression Region:1-149

Sequence Info:full length protein

View full details