Gene Bio Systems
Recombinant Pig 5-hydroxytryptamine receptor 1E(HTR1E)
Recombinant Pig 5-hydroxytryptamine receptor 1E(HTR1E)
SKU:CSB-CF639964PI
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Sus scrofa (Pig)
Uniprot NO.:Q29003
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:HQPANYLICSLAVTDLLVAVLVMPLSIMYIVMDSWRLGYFICEVWLSVDMTCCTCSILHL CVIALDRYWAITNAIEYARKRTAKRAGLMILTVWTISIFISMPPLFWRSHRQLSPPPSQC AIQHDHVIYTIYSTLGAFYIPLTLILILY
Protein Names:Recommended name: 5-hydroxytryptamine receptor 1E Short name= 5-HT-1E Short name= 5-HT1E Alternative name(s): Serotonin receptor 1E
Gene Names:Name:HTR1E
Expression Region:1-149
Sequence Info:full length protein
