Gene Bio Systems
Recombinant Pichia pastoris Cytochrome oxidase assembly protein 3, mitochondrial(COA3)
Recombinant Pichia pastoris Cytochrome oxidase assembly protein 3, mitochondrial(COA3)
SKU:CSB-CF505264EVR
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Pichia pastoris (strain GS115 / ATCC 20864) (Yeast)
Uniprot NO.:C4R127
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MAQPDKYYNKYTYQMSPAMLRARRPYFWKNMGAFGILGGISLSVYLYTYNFLMQDDFENI PIPPIKDEDLAALRREYEEKKQLSK
Protein Names:Recommended name: Cytochrome oxidase assembly protein 3, mitochondrial
Gene Names:Name:COA3 Ordered Locus Names:PAS_chr2-1_0565
Expression Region:1-85
Sequence Info:full length protein
