Skip to product information
1 of 1

Gene Bio Systems

Recombinant Pichia angusta Signal peptidase complex catalytic subunit SEC11(SEC11)

Recombinant Pichia angusta Signal peptidase complex catalytic subunit SEC11(SEC11)

SKU:CSB-CF518969EVP

Regular price £1,249.00 GBP
Regular price Sale price £1,249.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Pichia angusta (strain ATCC 26012 / NRRL Y-7560 / DL-1) (Yeast) (Hansenula polymorpha)

Uniprot NO.:E7R7C4

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNLRQQLGSGLSMAMVLASAFAFWKLFSIVTMSNSPIVVVLSGSMEPAFQRGDVLFLWNR EEYVGVGDVVVYKLQEKDIPIVHRVVREHRVMEKDRKTKKKVQKQLLLTKGDNNERDDLP LYAYGQQYLERKKDILGRVFGYVPLVGYVTILITENVYFKYALMALLGLSALVQDE

Protein Names:Recommended name: Signal peptidase complex catalytic subunit SEC11 EC= 3.4.21.89 Alternative name(s): Signal peptidase I

Gene Names:Name:SEC11 ORF Names:HPODL_2505

Expression Region:1-176

Sequence Info:full length protein

View full details