Gene Bio Systems
Recombinant Phleum pRatense Pollen allergen Phl p 5b
Recombinant Phleum pRatense Pollen allergen Phl p 5b
SKU:CSB-EP671435EUQ
Couldn't load pickup availability
>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug
Updated Date: Stock Protein updated on 20170405
Research areas: Others
Target / Protein:
Biologically active: Not Tested
Expression system: E.coli
Species of origin: Phleum pratense (Common timothy)
Delivery time: 3-7 business days
Uniprot ID: Q40963
AA Sequence: ADAGYAPATPAAAGAAAGKATTEEQKLIEDINVGFKAAVAAAASVPAADKFKTFEAAFTSSSKAAAAKAPGLVPKLDAAYSVAYKAAVGATPEAKFDSFVASLTEALRVIAGALEVHAVKPVTEEPGMAKIPAGELQIIDKIDAAFKVAATAAATAPADDKFTVFEAAFNKAIKESTGGAYDTYKCIPSLEAAVKQAYAATVAAAPQVKYAVFEAALTKAITAMSEVQKVSQPATGAATVAAGAATTAAGAASGAATVAAGGYKV
Tag info: N-terminal 6xHis-SUMO-tagged
Expression Region: 20-284aa
Protein length: Full Length
MW: 42.1 kDa
Alternative Name(s): Allergen Phl p Vb Allergen: Phl p 5b
Relevance: Has ribonuclease activity. May be involved in host-pathogen interactions.
Reference: "Major allergen Phl p Vb in timothy grass is a novel pollen RNase."Bufe A., Schramm G., Keown M.B., Schlaak M., Becker W.M.FEBS Lett. 363:6-12(1995)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
