Gene Bio Systems
Recombinant Phleum pRatense Pollen allergen Phl p 2(PHLPII)
Recombinant Phleum pRatense Pollen allergen Phl p 2(PHLPII)
SKU:CSB-EP337346GUQ
Couldn't load pickup availability
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Allergen
Uniprot ID: P43214
Gene Names: PHLPII
Organism: Phleum pratense (Common timothy)
AA Sequence: VPKVTFTVEKGSNEKHLAVLVKYEGDTMAEVELREHGSDEWVAMTKGEGGVWTFDSEEPLQGPFNFRFLTEKGMKNVFDDVVPEKYTIGATYAPEE
Expression Region: 27-122aa
Sequence Info: Full Length
Source: E.coli
Tag Info: N-terminal 6xHis-SUMO-tagged
MW: 26.8 kDa
Alternative Name(s): Allergen Phl p II Allergen: Phl p 2
Relevance:
Reference: "Molecular characterization of Phl p II, a major timothy grass (Phleum pratense) pollen allergen."Dolecek C., Vrtala S., Laffer S., Steinberger P., Kraft D., Scheiner O., Valenta R.FEBS Lett. 335:299-304(1993)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
