Skip to product information
1 of 1

Gene Bio Systems

Recombinant Phalaenopsis aphrodite subsp. formosana Cytochrome b559 subunit alpha(psbE)

Recombinant Phalaenopsis aphrodite subsp. formosana Cytochrome b559 subunit alpha(psbE)

SKU:CSB-CF661561PDAO

Regular price £1,166.00 GBP
Regular price Sale price £1,166.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Phalaenopsis aphrodite subsp. formosana (Moth orchid)

Uniprot NO.:Q3BAM3

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSGSTGERSFADIITSIRYWVIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYFTESR QGIPLITGRFDSLEQLDKFSNPF

Protein Names:Recommended name: Cytochrome b559 subunit alpha Alternative name(s): PSII reaction center subunit V

Gene Names:Name:psbE

Expression Region:1-83

Sequence Info:full length protein

View full details