Skip to product information
1 of 1

Gene Bio Systems

Recombinant Penicillium marneffei Protein get1(get1)

Recombinant Penicillium marneffei Protein get1(get1)

SKU:CSB-CF471979ETM

Regular price £1,268.00 GBP
Regular price Sale price £1,268.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Penicillium marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)

Uniprot NO.:B6Q234

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MISFLLLIFLIQLAIYIVNTIGSSTIDDLLWILYLRLPMPISKDTRKHGELKHDVVQLKR EMNATSSQDEFAKWAKLRRRHDKAMEEYEAMNRSMGSRKTSFQFSIKIARWLTLNGPRLF IQFYYTKTPVFDLPAGWFPYPVEWILSFPRAPLGSVSIQVWSSACATAISLAGDVVIAVV QRRQASNRQAQAVPAGKSEAATK

Protein Names:Recommended name: Protein get1 Alternative name(s): Guided entry of tail-anchored proteins 1

Gene Names:Name:get1 ORF Names:PMAA_027540

Expression Region:1-203

Sequence Info:full length protein

View full details