Gene Bio Systems
Recombinant Pelobacter propionicus Cobalt transport protein CbiM 2(cbiM2)
Recombinant Pelobacter propionicus Cobalt transport protein CbiM 2(cbiM2)
SKU:CSB-CF373426PYF
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Pelobacter propionicus (strain DSM 2379)
Uniprot NO.:A1ANE2
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MHIMEGFLPVEHAIGWSVASAPVVAYGLYSINKKIKKNPEQRMLLGVAAAFTFVLSALKM PSVTGSCSHPTGTGLGAILFGPSAVAPIGAVVLLFQALLLAHGGLTTLGANIFSMAIVGP FAAAAVFRLARAARFPFGVGVFLAASLGDLLTYVTTACQLAFAFPDPVGGFTASLAKFAG VFALTQIPLAISEGLLTVVVMNALLRFNREELGSLNIEGNGQEVQA
Protein Names:Recommended name: Cobalt transport protein CbiM 2 Alternative name(s): Energy-coupling factor transporter probable substrate-capture protein CbiM 2 Short name= ECF transporter S component CbiM 2
Gene Names:Name:cbiM2 Ordered Locus Names:Ppro_1241
Expression Region:1-226
Sequence Info:full length protein
