Skip to product information
1 of 1

Gene Bio Systems

Recombinant Pelobacter propionicus ATP synthase subunit c 2(atpE2)

Recombinant Pelobacter propionicus ATP synthase subunit c 2(atpE2)

SKU:CSB-CF373430PYF

Regular price £1,070.00 GBP
Regular price Sale price £1,070.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Pelobacter propionicus (strain DSM 2379)

Uniprot NO.:A1AP46

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSFFSMCVLGAAIGMAIGTLGTGIGQGLAVKSAVEGVSRNPGASGKIMTTMMIGLAMIES LAIYALVICLIILFANPYKDIALKLAETVAK

Protein Names:Recommended name: ATP synthase subunit c 2 Alternative name(s): ATP synthase F(0) sector subunit c 2 F-type ATPase subunit c 2 Short name= F-ATPase subunit c 2 Lipid-binding protein 2

Gene Names:Name:atpE2 Ordered Locus Names:Ppro_1501

Expression Region:1-91

Sequence Info:full length protein

View full details