Skip to product information
1 of 1

Gene Bio Systems

Recombinant Pelobacter propionicus ATP synthase subunit c 1(atpE1)

Recombinant Pelobacter propionicus ATP synthase subunit c 1(atpE1)

SKU:CSB-CF372721PYF

Regular price £1,172.00 GBP
Regular price Sale price £1,172.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Pelobacter propionicus (strain DSM 2379)

Uniprot NO.:A1ALL1

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNFFTMCVFGAAIGMAIGTLGTAIGQGMAVKSAVEGVARNPGAASKIMTTMMIGLAMIES LAIYALVVCLIILFANPYKDIALKMVETVAK

Protein Names:Recommended name: ATP synthase subunit c 1 Alternative name(s): ATP synthase F(0) sector subunit c 1 F-type ATPase subunit c 1 Short name= F-ATPase subunit c 1 Lipid-binding protein 1

Gene Names:Name:atpE1 Ordered Locus Names:Ppro_0600

Expression Region:1-91

Sequence Info:full length protein

View full details