Skip to product information
1 of 1

Gene Bio Systems

Recombinant Pelobacter propionicus ATP synthase subunit a 1(atpB1)

Recombinant Pelobacter propionicus ATP synthase subunit a 1(atpB1)

SKU:CSB-CF372456PYF

Regular price £1,292.00 GBP
Regular price Sale price £1,292.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Pelobacter propionicus (strain DSM 2379)

Uniprot NO.:A1ALL0

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MVHPLLFLEFFRKLLEPLHMSEAGADAVAYTWLIMLLLLLFSFLATRALKMIPCGLQNFM EVVVGGVENMIVETMGEHGRPYFPLVATVGLFVLVSNLIGLIPGFFPPTANINTTAACAI VVFIATHVVGIKRHGIGYIKHFCGPILWLAPVMFFIEVIGHLSRPLSLTLRLFGNMNGHE LVLIIFFGLAPFLVPLPMMLMGVLVSFIQAFVFMLLTMIYIQGSLEEAH

Protein Names:Recommended name: ATP synthase subunit a 1 Alternative name(s): ATP synthase F0 sector subunit a 1 F-ATPase subunit 6 1

Gene Names:Name:atpB1 Ordered Locus Names:Ppro_0599

Expression Region:1-229

Sequence Info:full length protein

View full details