Skip to product information
1 of 1

Gene Bio Systems

Recombinant Pectobacterium wasabiae L-alanine exporter AlaE(alaE)

Recombinant Pectobacterium wasabiae L-alanine exporter AlaE(alaE)

SKU:CSB-CF513212ESS

Regular price £1,223.00 GBP
Regular price Sale price £1,223.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Pectobacterium wasabiae (strain WPP163)

Uniprot NO.:D0KMH4

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MFSPTSRLRSATADTFALVVYCFIIGMAIEIMLSGMSFEQSLSSRLLSIPVNIAIAWPYG LYRDRVLNMAKRHGGDHFLVRSVADLFAYVSFQSPVYAAILWVIGASSAQILTAVTSNLV ISMVMGVTYGYFLEYCRRLFRVALP

Protein Names:Recommended name: L-alanine exporter AlaE

Gene Names:Name:alaE Ordered Locus Names:Pecwa_3790

Expression Region:1-145

Sequence Info:full length protein

View full details