Skip to product information
1 of 1

Gene Bio Systems

Recombinant Pectobacterium carotovorum subsp. carotovorum UPF0299 membrane protein PC1_1498 (PC1_1498)

Recombinant Pectobacterium carotovorum subsp. carotovorum UPF0299 membrane protein PC1_1498 (PC1_1498)

SKU:CSB-CF511929ESQ

Regular price £1,215.00 GBP
Regular price Sale price £1,215.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Pectobacterium carotovorum subsp. carotovorum (strain PC1)

Uniprot NO.:C6DDT0

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MRNTFIVCWQYLRAFALIYLCLLAGNAVSALLPFTIPGSIIGMLVLFTLLASQILPAQWV KPGCHLLIRHMALLFVPIGVGVMNYYDLVSQQFGPIVVSCLISTFIVMLVVGFSTQIMQR ERAMAGDRTPPKDNE

Protein Names:Recommended name: UPF0299 membrane protein PC1_1498

Gene Names:Ordered Locus Names:PC1_1498

Expression Region:1-135

Sequence Info:full length protein

View full details