Gene Bio Systems
Recombinant Pectobacterium carotovorum subsp. carotovorum UPF0208 membrane protein PC1_2779 (PC1_2779)
Recombinant Pectobacterium carotovorum subsp. carotovorum UPF0208 membrane protein PC1_2779 (PC1_2779)
SKU:CSB-CF509641ESQ
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Uniprot NO.:C6DA53
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MATKPDSRISWLQLLQRGQHYMKTWPAEKQLAPVFPENRVARATRFGIRIMPPLAVFTLT WQIALGGQLGPAIATALFACSLPLQGLWWLGRRSVTPLPPTLAQWFHEIRHKLLESGQAL APLEEAPTYQSLADVLKRAFSQLDKTFLDDL
Protein Names:Recommended name: UPF0208 membrane protein PC1_2779
Gene Names:Ordered Locus Names:PC1_2779
Expression Region:1-151
Sequence Info:full length protein
