Recombinant Pectobacterium carotovorum subsp. carotovorum Flagellar biosynthetic protein FliQ(fliQ)

SKU: CSB-CF339424ESP

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Pectobacterium carotovorum subsp. carotovorum (Erwinia carotovora subsp. carotovora)

Uniprot NO.:P34201

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTPESVMALGYEAMKVALALAAPPLMAALLSGLLISLLQAATQINEMTLSFIPKILTVFF TLVIAGPWMLNLMLDYMRTLFGQLPNIIG

Protein Names:Recommended name: Flagellar biosynthetic protein FliQ Alternative name(s): Flagellar biosynthetic protein MopD

Gene Names:Name:fliQ Synonyms:mopD

Expression Region:1-89

Sequence Info:full length protein