Gene Bio Systems
Recombinant Pea enation mosaic virus-1 Protein P1(ORF1)
Recombinant Pea enation mosaic virus-1 Protein P1(ORF1)
SKU:CSB-CF774577PDX
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Pea enation mosaic virus-1 (strain WSG) (PEMV-1)
Uniprot NO.:Q84710
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:SYRTFIGSNKVALLSIRKLEEELSRGPIGLWADDTEDDESAPRRSGNGLFRSTPEKQSQA KTPSPKVEESAAPPPAPRAEKVRHVRRSEMTPEQKRADNLRRRKAKAAKKTPSTPPKKSK DKAPTLSQVAELVEKAVRAALTVQPRRSRASSKISIGGRNPGRKPQVSIQLDPVPSQSTS VPPKDSQAGESAWLGPRRSYRPVQKSTVGQKQEPRRN
Protein Names:Recommended name: Protein P1 Alternative name(s): Genome-linked protein precursor ORF1 protein Cleaved into the following 3 chains: 1. Serine protease EC= 2. 3.4.21.- 3. VPg 4. P1-C25
Gene Names:ORF Names:ORF1
Expression Region:544-760
Sequence Info:full length protein
