Gene Bio Systems
Recombinant Paramecium bursaria Chlorella virus 1 Potassium channel protein kcv(A250R)
Recombinant Paramecium bursaria Chlorella virus 1 Potassium channel protein kcv(A250R)
SKU:CSB-CF800996ERU
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Paramecium bursaria Chlorella virus 1 (PBCV-1)
Uniprot NO.:Q84568
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MLVFSKFLTRTEPFMIHLFILAMFVMIYKFFPGGFENNFSVANPDKKASWIDCIYFGVTT HSTVGFGDILPKTTGAKLCTIAHIVTVFFIVLTL
Protein Names:Recommended name: Potassium channel protein kcv
Gene Names:Name:A250R
Expression Region:1-94
Sequence Info:full length protein
