Skip to product information
1 of 1

GeneBio Systems

Recombinant Papio hamadryas Sperm acrosome membrane-associated protein 3 (SPACA3), partial

Recombinant Papio hamadryas Sperm acrosome membrane-associated protein 3 (SPACA3), partial

SKU:B6VH79

Regular price £735.00 GBP
Regular price Sale price £735.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Developmental Biology

Uniprot ID: B6VH79

Gene Names: SPACA3

Alternative Name(s): (Sperm protein reactive with antisperm antibodies)(Sperm protein reactive with ASA)(Fragment)

Abbreviation: Recombinant Papio hamadryas SPACA3 protein, partial

Organism: Papio hamadryas (Hamadryas baboon)

Source: E.coli

Expression Region: 87-166aa

Protein Length: Partial

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Target Protein Sequence: KVYSRCELARVLQDFGLDGYRGYSLADWVCLAYFTSGFNAAALDYEADGSTNNGIFQINSRRWCSNLTPNVPNVCRMYCS

MW: 16.5 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: Sperm surface membrane protein that may be involved in sperm-egg plasma membrane adhesion and fusion during fertilization. It could be a potential receptor for the egg oligosaccharide residue N-acetylglucosamine, which is present in the extracellular matrix over the egg plasma membrane. The processed form has no detectable bacteriolytic activity in vitro.

Reference: "Evolutionary conservation of SPRASA in various animal species." Prendergast D., Woad K.J., Chamley L.W., Shelling A.N.

Function:

View full details