Skip to product information
1 of 1

GeneBio Systems

Recombinant Pan troglodytes Slit guidance ligand 3 (SLIT3), partial

Recombinant Pan troglodytes Slit guidance ligand 3 (SLIT3), partial

SKU:H2QRZ2

Regular price £484.00 GBP
Regular price Sale price £484.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Others

Uniprot ID: H2QRZ2

Gene Names: SLIT3

Alternative Name(s):

Abbreviation: Recombinant Chimpanzee SLIT3 protein, partial

Organism: Pan troglodytes (Chimpanzee)

Source: E.coli

Expression Region: 309-438aa

Protein Length: Partial

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Target Protein Sequence: IVEIRLEQNSIKAIPAGAFTQYKKLKRIDISKNQISDIAPDAFQGLKSLTSLVLYGNKITEIAKGLFDGLVSLQLLLLNANKINCLRVNTFQDLQNLNLLSLYDNKLQTISKGLFAPLQSIQTLHLAQNP

MW: 21.9 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance:

Reference: "Identification of transcripts with enriched expression in the developing and adult pancreas." Hoffman B.G., Zavaglia B., Witzsche J., Ruiz de Algara T., Beach M., Hoodless P.A., Jones S.J., Marra M.A., Helgason C.D. Genome Biol 9: R99-R99(2008)

Function:

View full details