Recombinant Pan troglodytes Cell cycle control protein 50C(TMEM30C)

SKU: CSB-CF023827EQV

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Pan troglodytes (Chimpanzee)

Uniprot NO.:A0ZT23

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MEERAQHCLSRLLDNSALKQQELPIHRLYFTARRVLFVFFATGIFCLCMGIILILSARSTQEIEINYTRICANCAKLQENASNFDKECTCSIPFYLSGKMMGNVYMYYKLYGFYQNLYLYIRSRSNRQLVGKDVKVRLNLIWYNTLFLFLNQVDFSV

Protein Names:Recommended name: Cell cycle control protein 50C Alternative name(s): Transmembrane protein 30C

Gene Names:Name:TMEM30C Synonyms:CDC50C

Expression Region:1-157

Sequence Info:full length protein