Skip to product information
1 of 1

Gene Bio Systems

Recombinant Pan paniscus Taste receptor type 2 member 19(TAS2R19)

Recombinant Pan paniscus Taste receptor type 2 member 19(TAS2R19)

SKU:CSB-CF723080EQU

Regular price £1,352.00 GBP
Regular price Sale price £1,352.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Pan paniscus (Pygmy chimpanzee) (Bonobo)

Uniprot NO.:Q5Y4Z5

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MMCFLLIILSILVVFAFVLGNFSNGFIALVNVIDWVNTRKISSADQILTALVVSRIGLLW VMLFLWYATVFNSALYGLEVRIVASNAWAVMNHFSIWLAASLSIFCLLKIANFSNLIFLH LKKRIKSVVLVILLGPLVFLICNLAVITMDERVWTKEYEGNVTWKIKLRNAIQLSSLTVT TLANLIPFTLSLICFLLLICSLCKHLKKMRLHSKGSQDPSTKVHIKALQTVTSFLMLFAI YFLCIITSTWNLRTQQSKLVLLLCQTVAIMYPSFHSFILIMGSRKLKQTFLSVLWQMTR

Protein Names:Recommended name: Taste receptor type 2 member 19 Alternative name(s): Taste receptor type 2 member 48 Short name= T2R48

Gene Names:Name:TAS2R19 Synonyms:TAS2R48

Expression Region:1-299

Sequence Info:full length protein

View full details