Skip to product information
1 of 1

Gene Bio Systems

Recombinant Pan paniscus NADH-ubiquinone oxidoreductase chain 4L(MT-ND4L)

Recombinant Pan paniscus NADH-ubiquinone oxidoreductase chain 4L(MT-ND4L)

SKU:CSB-CF655677EQU-GB

Regular price £1,195.00 GBP
Regular price Sale price £1,195.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Pan paniscus (Pygmy chimpanzee) (Bonobo)

Uniprot NO.:Q35588

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MPLIYMNIMLAFTISLLGMLVYRSHLMSSLLCLEGMMLSLFIMTTLMTLNTHSLLANIVP ITMLVFAACEAAVGLALLVSISNTYGLDYVHNLNLLQC

Protein Names:Recommended name: NADH-ubiquinone oxidoreductase chain 4L EC= 1.6.5.3 Alternative name(s): NADH dehydrogenase subunit 4L

Gene Names:Name:MT-ND4L Synonyms:MTND4L, NADH4L, ND4L

Expression Region:1-98

Sequence Info:full length protein

View full details