Gene Bio Systems
Recombinant Paenibacillus macerans Cyclomaltodextrin glucanotransferase,partial
Recombinant Paenibacillus macerans Cyclomaltodextrin glucanotransferase,partial
SKU:CSB-EP327084EQJ
Couldn't load pickup availability
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Microbiology
Uniprot ID: P31835
Gene Names: N/A
Organism: Paenibacillus macerans (Bacillus macerans)
AA Sequence: VLTADQVTVRFKVNNATTALGQNVYLTGNVAELGNWTAANAIGPMYNQVEASYPTWYFDVSVPANTALQFKFIKVNGSTVTWEGGNNHTFTSPSSGVATVTVDWQN
Expression Region: 608-713aa
Sequence Info: Partial
Source: E.coli
Tag Info: N-terminal 6xHis-SUMO-tagged
MW: 27.4 kDa
Alternative Name(s): Cyclodextrin-glycosyltransferase Short name:CGTase
Relevance:
Reference: "Polypeptide possessing cyclomaltodextrin glucanotransferase activity."Sugimoto T., Kubota M., Sakai S.Patent number GB2169902, 23-JUL-1986
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
