Recombinant Oxyuranus microlepidotus Toxin 3FTx-Oxy6

SKU: CSB-EP415963OGE

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: Yes

Lead time: 3-7 working days

Research Topic: Others

Uniprot ID: A7X4T2

Gene Names: N/A

Organism: Oxyuranus microlepidotus (Inland taipan)

AA Sequence: LKCHESENLDDHVVCEEDETMCYKFTFVPFRDFEIVARGCSASCPEEKDVVCCSTDLCNK

Expression Region: 22-81aa

Sequence Info: Full Length of Mature Protein

Source: E.coli

Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

MW: 26.9 kDa

Alternative Name(s):

Relevance:

Reference: "Evolution of an arsenal: structural and functional diversification of the venom system in the advanced snakes (Caenophidia)." Fry B.G., Scheib H., van der Weerd L., Young B., McNaughtan J., Ramjan S.F.R., Vidal N., Poelmann R.E., Norman J.A. Mol. Cell. Proteomics 7:215-246(2008)

Purity: Greater than 85% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer，50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.