Gene Bio Systems
Recombinant Osgoodomys banderanus NADH-ubiquinone oxidoreductase chain 3(MT-ND3)
Recombinant Osgoodomys banderanus NADH-ubiquinone oxidoreductase chain 3(MT-ND3)
SKU:CSB-CF015078OFL-GB
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Osgoodomys banderanus (Michoacan deer mouse) (Peromyscus banderanus)
Uniprot NO.:O21601
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MNMFMALSVNIILSTCLILIAFWLPQLNLYNEKANPYECGFDQSSTARLPFSMKFFLVAI TFLLFDLEIALLLPLPWAIQMYSINTMMLTAFILVSILALGLAYEWVQKGLEWTE
Protein Names:Recommended name: NADH-ubiquinone oxidoreductase chain 3 EC= 1.6.5.3 Alternative name(s): NADH dehydrogenase subunit 3
Gene Names:Name:MT-ND3 Synonyms:MTND3, NADH3, ND3
Expression Region:1-115
Sequence Info:full length protein