Skip to product information
1 of 1

Gene Bio Systems

Recombinant Oryza sativa subsp. japonica Vacuolar iron transporter homolog 4(Os11g0161900, LOC_Os11g06310)

Recombinant Oryza sativa subsp. japonica Vacuolar iron transporter homolog 4(Os11g0161900, LOC_Os11g06310)

SKU:CSB-CF706640OFG

Regular price £1,286.00 GBP
Regular price Sale price £1,286.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Oryza sativa subsp. japonica (Rice)

Uniprot NO.:Q53PN2

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAATNGDAELTVAEEAKEEEEATDDGGGGVSSQWLRAAVLGASDGLVSTAALMLGIGAAR PADARAVLLSGLAGLVAGACSMAIGEYVSVHVQLDVELADLERRRRRGGPAPAGLGLHAA AAAVSRPGQAAAASALSFAAGAALPLLAAWFVAGAYRVRVVVVVATASLALAAFGAAGAR LGRAPGGRAGLRVVVGGLLAMAATYGVMKLFRTHGV

Protein Names:Recommended name: Vacuolar iron transporter homolog 4 Alternative name(s): Protein NODULIN-LIKE 4

Gene Names:Ordered Locus Names:Os11g0161900, LOC_Os11g06310

Expression Region:1-216

Sequence Info:full length protein

View full details