Skip to product information
1 of 1

Gene Bio Systems

Recombinant Oryza sativa subsp. japonica Putative ammonium transporter 4 member 1(AMT4-1)

Recombinant Oryza sativa subsp. japonica Putative ammonium transporter 4 member 1(AMT4-1)

SKU:CSB-CF607459OFG

Regular price £1,358.00 GBP
Regular price Sale price £1,358.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Oryza sativa subsp. japonica (Rice)

Uniprot NO.:Q10CV4

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAAEAAPEWVEKGDNAWPLAAATLVGLQSVPRLVILYGDCGAVGPRTEKDREAFPPNNVL LTLAGAGLLLWMGWTGFNGGAPYAANVDASVTVVNTHLCTATSLLVWLLLDSFVFGRLSV ISAVQGMITGLVCVTPAARLVLHKRSRLLARVDDTLAVLHTHGVAGSLSGVLTGLLLLAE PRFARLFFGDDPRYVGLAYAVRDGRAGSGLRQVGVQLAGIAFVVALNVAVTSAVCLAVRV AVPQLAGGGDAIHGEDAYAVWGDGETYEQYSVHGGGSNHGGFPMTANPVASKADEMIWI

Protein Names:Recommended name: Putative ammonium transporter 4 member 1 Short name= OsAMT4;1

Gene Names:Name:AMT4-1 Ordered Locus Names:Os03g0749000, Os03g0749050, LOC_Os03g53780 ORF Names:OSJNBa0069E14.17

Expression Region:1-299

Sequence Info:full length protein

View full details