Skip to product information
1 of 1

Gene Bio Systems

Recombinant Oryza sativa subsp. japonica Probable aquaporin TIP4-1(TIP4-1)

Recombinant Oryza sativa subsp. japonica Probable aquaporin TIP4-1(TIP4-1)

SKU:CSB-CF745044OFG

Regular price £1,315.00 GBP
Regular price Sale price £1,315.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Oryza sativa subsp. japonica (Rice)

Uniprot NO.:Q75GA5

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAKEVDPCDHGEVVDAGCVRAVLAELVLTFVFVFTGVAATMAAGVPEVAGAAMPMAALAG VAIATALAAGVLVTAGFHVSGGHLNPAVTVALLARGHITAFRSALYVAAQLLASSLACIL LRYLTGGMATPVHTLGSGIGPMQGLVMEIILTFSLLFVVYATILDPRSSVPGFGPLLTGL IVGANTIAGGNFSGASMNPARSFGPALATGVWTHHWIYWLGPLIGGPLAGLVYESLFLVK RTHEPLLDNSF

Protein Names:Recommended name: Probable aquaporin TIP4-1 Alternative name(s): Tonoplast intrinsic protein 4-1 Short name= OsTIP4;1

Gene Names:Name:TIP4-1 Ordered Locus Names:Os05g0231700, LOC_Os05g14240 ORF Names:OsJ_016926, OSJNBa0042F15.10

Expression Region:1-251

Sequence Info:full length protein

View full details