Skip to product information
1 of 1

Gene Bio Systems

Recombinant Oryza sativa subsp. japonica Probable aquaporin TIP3-2(TIP3-2)

Recombinant Oryza sativa subsp. japonica Probable aquaporin TIP3-2(TIP3-2)

SKU:CSB-CF801726OFG

Regular price £1,329.00 GBP
Regular price Sale price £1,329.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Oryza sativa subsp. japonica (Rice)

Uniprot NO.:Q7XKI5

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MLPGRHTPRRADAAAAAAAMEPLVPGATRAALSEFVATAVFVFAAEGSVYGLWKMYRDTG TLGGLLVVAVAHALALAAAVAVSRNASGGHVNPAVTFGVLVGRRISFARAALYWAAQLLG AVLAVLLLRLASGGMRPMGFTLGHRIHERHALLLEVVMTFGLVYTVYATAVDRRSGGGDI APLAIGLVAGANILAGGPFDGAAMNPARAFGPALVGWNWRHHWVYWLGPLIGAGMAGALY EFVMAEQPEPPAAADTRLPVAAEDY

Protein Names:Recommended name: Probable aquaporin TIP3-2 Alternative name(s): Tonoplast intrinsic protein 3-2 Short name= OsTIP3;2

Gene Names:Name:TIP3-2 Ordered Locus Names:Os04g0527900, LOC_Os04g44570 ORF Names:OsJ_014891, OSJNBa0038O10.23

Expression Region:1-265

Sequence Info:full length protein

View full details