Skip to product information
1 of 1

Gene Bio Systems

Recombinant Oryza sativa subsp. japonica Probable aquaporin TIP3-1(TIP3-1)

Recombinant Oryza sativa subsp. japonica Probable aquaporin TIP3-1(TIP3-1)

SKU:CSB-CF872332OFG

Regular price £1,328.00 GBP
Regular price Sale price £1,328.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Oryza sativa subsp. japonica (Rice)

Uniprot NO.:Q9FWV6

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSTAAARPGRRFTVGRSEDATHPDTIRAAISEFLATAIFVFAAEGSILSLGKLYQDMSTP GGLVAVSLAHALALAVAVAVAVNISGGHVNPAITFGALLGGRLSLIRALFYWLAQLLGAV VATLLLRLTTGGMRPPGFALASGVGDWHAVLLEATMTFGLMYAYYATVIDPKRGHVGTIA PLAVGFLLGANMLAGGPFDGAGMNPARVFGPALVGWRWRHHWVYWLGPFVGAGLAGLLYE YLVIPSADAAPHGGAHQPLAPEDY

Protein Names:Recommended name: Probable aquaporin TIP3-1 Alternative name(s): Tonoplast intrinsic protein 3-1 Short name= OsTIP3;1

Gene Names:Name:TIP3-1 Synonyms:TIP3 Ordered Locus Names:Os10g0492600, LOC_Os10g35050 ORF Names:OsJ_030736, OSJNBa0051D19.19

Expression Region:1-264

Sequence Info:full length protein

View full details