Skip to product information
1 of 1

Gene Bio Systems

Recombinant Oryza sativa subsp. japonica Probable aquaporin TIP2-1(TIP2-1)

Recombinant Oryza sativa subsp. japonica Probable aquaporin TIP2-1(TIP2-1)

SKU:CSB-CF773505OFG

Regular price £1,325.00 GBP
Regular price Sale price £1,325.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Oryza sativa subsp. japonica (Rice)

Uniprot NO.:Q7XA61

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MVKLAFGSLGDSFSATSVKAYVAEFIATLLFVFAGVGSAIAYGQLTNGGALDPAGLVAIA IAHALALFVGVSVAANISGGHLNPAVTFGLAVGGHITILTGLFYWIAQLLGASIACLLLK FVTHGKAIPTHGVAGISELEGVVMEIVITFALVYTVYATAADPKKGSLGTIAPIAIGFIV GANILAAGPFSGGSMNPARSFGPAVAAGNFAGNWVYWVGPLIGGGLAGLVYGDVFIGSYQ PVADQDYA

Protein Names:Recommended name: Probable aquaporin TIP2-1 Alternative name(s): Tonoplast intrinsic protein 2-1 Short name= OsTIP2;1

Gene Names:Name:TIP2-1 Synonyms:TIP2, W950ERIPDM Ordered Locus Names:Os02g0658100, LOC_Os02g44080 ORF Names:OJ1112_F09.18, OsJ_007553, P0519E06.48

Expression Region:1-248

Sequence Info:full length protein

View full details