Skip to product information
1 of 1

Gene Bio Systems

Recombinant Oryza sativa subsp. japonica Probable aquaporin PIP2-1(PIP2-1)

Recombinant Oryza sativa subsp. japonica Probable aquaporin PIP2-1(PIP2-1)

SKU:CSB-CF808450OFG

Regular price £1,350.00 GBP
Regular price Sale price £1,350.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Oryza sativa subsp. japonica (Rice)

Uniprot NO.:Q8H5N9

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MGKDEVMESGGAAGEFAAKDYTDPPPAPLIDAAELGSWSLYRAVIAEFIATLLFLYITVA TVIGYKHQTDASASGADAACGGVGVLGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLF LARKVSLVRAILYIVAQCLGAICGVGLVKAFQSAYFNRYGGGANTLAAGYSKGTGLAAEI IGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSIGA AVIFNNEKAWHNHWIFWVGPFVGAAIAAFYHQYILRAGAIKALGSFRSNA

Protein Names:Recommended name: Probable aquaporin PIP2-1 Alternative name(s): OsPIP2;1 Plasma membrane intrinsic protein 2-1 Plasma membrane intrinsic protein 2a Short name= PIP2a

Gene Names:Name:PIP2-1 Synonyms:PIP2a Ordered Locus Names:Os07g0448800, LOC_Os07g26690 ORF Names:OJ1047_A06.117, OsJ_023145

Expression Region:1-290

Sequence Info:full length protein

View full details