Skip to product information
1 of 1

Gene Bio Systems

Recombinant Oryza sativa subsp. japonica Oleosin 18 kDa(OLE18)

Recombinant Oryza sativa subsp. japonica Oleosin 18 kDa(OLE18)

SKU:CSB-CF606058OFG

Regular price £1,243.00 GBP
Regular price Sale price £1,243.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Oryza sativa subsp. japonica (Rice)

Uniprot NO.:Q10EK7

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:ADRDRAGQYYQQQRGQVGETVKGILPEKAPSASQALTVATLFPLGGLLLVLSGLALAASV VGLAVATPVFLIFSPVLVPAALLIGLAVAGFLTSGALGLGGLSSLTFLANTARQAFQRTP DYVEQARRRMAEAAAHAGHKTAQAGHAIQGRADQAGTGAGAGGGAGTKTSS

Protein Names:Recommended name: Oleosin 18 kDa Alternative name(s): OSE721

Gene Names:Name:OLE18 Ordered Locus Names:Os03g0699000, LOC_Os03g49190 ORF Names:OsJ_011734, OSJNBb0017F17.17

Expression Region:2-172

Sequence Info:full length protein

View full details