Gene Bio Systems
Recombinant Oryza sativa subsp. japonica Oleosin 16 kDa(OLE16)
Recombinant Oryza sativa subsp. japonica Oleosin 16 kDa(OLE16)
SKU:CSB-CF669261OFG
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Oryza sativa subsp. japonica (Rice)
Uniprot NO.:Q42980
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:ADQHRGVIGGGGYGDRGGQEQQEKQRFMMTALKTVTAATAGGSMLVLSGLILAGTVIALT VATPVLVIFSPVLVPAAIALALMAAGFVTSGGLGVAALSVFSWMYKYLTGKHPPGADQLD HAKARLASKARDIKEAAQHRIDQAQAS
Protein Names:Recommended name: Oleosin 16 kDa Alternative name(s): OSE701
Gene Names:Name:OLE16 Synonyms:1CP, OSE375 Ordered Locus Names:Os04g0546500, LOC_Os04g46200 ORF Names:OSJNBa0079A21.14
Expression Region:2-148
Sequence Info:full length protein
