Skip to product information
1 of 1

Gene Bio Systems

Recombinant Oryza sativa subsp. japonica GDT1-like protein 5 (Os08g0433100, LOC_Os08g33630)

Recombinant Oryza sativa subsp. japonica GDT1-like protein 5 (Os08g0433100, LOC_Os08g33630)

SKU:CSB-CF496202OFG

Regular price £1,313.00 GBP
Regular price Sale price £1,313.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Oryza sativa subsp. japonica (Rice)

Uniprot NO.:B9G125

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAPSLLGGFTKSLAMTVLSEIGDKTFFAAAILAMRYPRKLVLAGCLTSLTVMTALSVSLG WVAPNLISRKWTHHVTTLLFFVFGILSLWEGFKEDGDSEELAEVEAELDANFKSNKAESK SKSKANDDKKKQQRPFVLQFFSPIFIKAFSITFFGEWGDKSQIATIGLAADENPFGVVLG GVLAQALCTTAAVMGGKSLASQISEKMVGLSSGVLFLLFGIMSYLSGPEGEL

Protein Names:Recommended name: GDT1-like protein 5

Gene Names:Ordered Locus Names:Os08g0433100, LOC_Os08g33630 ORF Names:OsJ_27425, P0431A03.16

Expression Region:1-232

Sequence Info:full length protein

View full details