Skip to product information
1 of 1

Gene Bio Systems

Recombinant Oryza sativa subsp. japonica E3 ubiquitin-protein ligase Os06g0535400(Os06g0535400, LOC_Os06g34450)

Recombinant Oryza sativa subsp. japonica E3 ubiquitin-protein ligase Os06g0535400(Os06g0535400, LOC_Os06g34450)

SKU:CSB-CF736538OFG

Regular price £1,317.00 GBP
Regular price Sale price £1,317.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Oryza sativa subsp. japonica (Rice)

Uniprot NO.:Q5Z5F2

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MELPWLDLPFTLLTLLLATRLAYDYYGVVAATFTGSFSLQIFLFYCFARWYRHTIAARAA ADADGDGGGGAVADEEAAPPVLIPLLEGRGGGGGGAGAASSLANRCFAVVFMVFVPLVIV VFERSQADVVAYALCLANILVMVVWLSPDAAADPASAAKSFLRLSDDEDEGSCSGSGHGA AEDKCCVCLAGMREAQALRDLPRCGHRFHAKCIGKWLTAHPTCPVCRTTAVPPPAPLPAS GDHADDAITPV

Protein Names:Recommended name: E3 ubiquitin-protein ligase Os06g0535400 EC= 6.3.2.- Alternative name(s): RING-H2 finger protein Os06g0535400

Gene Names:Ordered Locus Names:Os06g0535400, LOC_Os06g34450 ORF Names:OSJNBa0001B21.23

Expression Region:1-251

Sequence Info:full length protein

View full details