Skip to product information
1 of 1

Gene Bio Systems

Recombinant Oryza sativa subsp. japonica Defender against cell death 1(DAD1)

Recombinant Oryza sativa subsp. japonica Defender against cell death 1(DAD1)

SKU:CSB-CF006487OFG

Regular price £1,195.00 GBP
Regular price Sale price £1,195.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Oryza sativa subsp. japonica (Rice)

Uniprot NO.:Q0JDK9

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MPRATSDAKLLIQSLGKAYAATPTNLKIIDLYVVFAVATALIQVVYMGIVGSFPFNSFLS GVLSCIGTAVLAVCLRIQVNKDNKEFKDLPPERAFADFVLCNLVLHLVIMNFLG

Protein Names:Recommended name: Defender against cell death 1 Short name= DAD-1 Alternative name(s): Defender against apoptotic death 1 protein

Gene Names:Name:DAD1 Synonyms:DAD-1 Ordered Locus Names:Os04g0397000, LOC_Os04g32550 ORF Names:OsJ_014065, OSJNBa0039C07.3

Expression Region:1-114

Sequence Info:full length protein

View full details