Skip to product information
1 of 1

Gene Bio Systems

Recombinant Oryza sativa subsp. japonica Chlorophyll a-b binding protein, chloroplastic(RCABP89)

Recombinant Oryza sativa subsp. japonica Chlorophyll a-b binding protein, chloroplastic(RCABP89)

SKU:CSB-CF606059OFG

Regular price £1,292.00 GBP
Regular price Sale price £1,292.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Oryza sativa subsp. japonica (Rice)

Uniprot NO.:Q10HD0

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:RRTVKSAPQSIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNREL EVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLVHAQSI LAIWAVQVVLMGFVEGYRVGGGPLGEGLDKVYPGGAFDPLGLADDPDTFAELKVKELKNG RLAMFSMFGFFVQAIVTGKGPIENLFDHVADPVANNAWAYATNFVPGK

Protein Names:Recommended name: Chlorophyll a-b binding protein, chloroplastic Alternative name(s): LHCII type I CAB Short name= LHCP

Gene Names:Name:RCABP89 Ordered Locus Names:Os03g0592500, LOC_Os03g39610 ORF Names:OsJ_011145, OSJNBb0056O10.8

Expression Region:36-263

Sequence Info:full length protein

View full details